SWAP70 MaxPab rabbit polyclonal antibody (D01)
  • SWAP70 MaxPab rabbit polyclonal antibody (D01)

SWAP70 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00023075-D01
SWAP70 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SWAP70 protein.
Información adicional
Size 100 uL
Gene Name SWAP70
Gene Alias FLJ39540|HSPC321|KIAA0640|SWAP-70
Gene Description SWAP-70 protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MGSLKEELLKAIWHAFTALDQDHSGKVSKSQLKVLSHNLCTVLKVPHDPVALEEHFRDDDEGPVSNQGYMPYLNRFILEKVQDNFDKIEFNRMCWTLCVKKNLTKNPLLITEEDAFKIWVIFNFLSEDKYPLIIVSEEIEYLLKKLTEAMGGGWQQEQFEHYKINFDDSKNGLSAWELIELIGNGQFSKGMDRQTVSMAINEVFNELILDVLKQGYMMKKGHRRKNWTERWFVLKPNIISYYVSEDLKDKKGDIL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SWAP70 (NP_055870.2, 1 a.a. ~ 585 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 23075

Enviar un mensaje


SWAP70 MaxPab rabbit polyclonal antibody (D01)

SWAP70 MaxPab rabbit polyclonal antibody (D01)