WAPAL MaxPab rabbit polyclonal antibody (D01)
  • WAPAL MaxPab rabbit polyclonal antibody (D01)

WAPAL MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00023063-D01
WAPAL MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human WAPAL protein.
Información adicional
Size 100 uL
Gene Name WAPAL
Gene Alias FOE|KIAA0261|WAPL
Gene Description wings apart-like homolog (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MDLDRASLDLMIRLLELEQDASSAKLLNEKDMNKIKEKIRRLCETVHNKHLDLENITTGHLAMETLLSLTSKRAGDWFKEELRLLGGLDHIVDKVKECVDHLSRDEDEEKLVASLWGAERCLRVLESVTVHNPENQSYLIAYKDSQLIVSSAKALQHCEELIQQYNRAEDSICLADSKPLPHQNVTNHVGKAVEDCMRAIIGVLLNLTNDNEWGSTKTGEQDGLIGTALNCVLQVPKYLPQEQRFDIRVLLFLER
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen WAPAL (ENSP00000263070, 1 a.a. ~ 402 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 23063

Enviar un mensaje


WAPAL MaxPab rabbit polyclonal antibody (D01)

WAPAL MaxPab rabbit polyclonal antibody (D01)