NMNAT2 polyclonal antibody (A01)
  • NMNAT2 polyclonal antibody (A01)

NMNAT2 polyclonal antibody (A01)

Ref: AB-H00023057-A01
NMNAT2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NMNAT2.
Información adicional
Size 50 uL
Gene Name NMNAT2
Gene Alias C1orf15|KIAA0479|MGC2756|PNAT-2|PNAT2
Gene Description nicotinamide nucleotide adenylyltransferase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq CIPGLWNEADMEVIVGDFGIVVVPRDAADTDRIMNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQLYINASG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NMNAT2 (NP_055854, 208 a.a. ~ 307 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23057

Enviar un mensaje


NMNAT2 polyclonal antibody (A01)

NMNAT2 polyclonal antibody (A01)