SMG1 monoclonal antibody (M03), clone 1C12
  • SMG1 monoclonal antibody (M03), clone 1C12

SMG1 monoclonal antibody (M03), clone 1C12

Ref: AB-H00023049-M03
SMG1 monoclonal antibody (M03), clone 1C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SMG1.
Información adicional
Size 100 ug
Gene Name SMG1
Gene Alias 61E3.4|ATX|KIAA0421|LIP
Gene Description SMG1 homolog, phosphatidylinositol 3-kinase-related kinase (C. elegans)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq PDVMSQNARKLIQKNLATSADTPPSTVPGTGKSVACSPKKAVRDPKTGKAVQERNSYAVSVWKRVKAKLEGRDVDPNRRMSVAEQVDYVIKEATNLDNLAQLYEGWTAWV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SMG1 (NP_055535, 2922 a.a. ~ 3031 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23049
Clone Number 1C12
Iso type IgG1 Kappa

Enviar un mensaje


SMG1 monoclonal antibody (M03), clone 1C12

SMG1 monoclonal antibody (M03), clone 1C12