KIF21B monoclonal antibody (M03), clone 4C12
  • KIF21B monoclonal antibody (M03), clone 4C12

KIF21B monoclonal antibody (M03), clone 4C12

Ref: AB-H00023046-M03
KIF21B monoclonal antibody (M03), clone 4C12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KIF21B.
Información adicional
Size 100 ug
Gene Name KIF21B
Gene Alias FLJ16314
Gene Description kinesin family member 21B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq VSRTVSLPTRGSTFPRQSRATETSPLTRRKSYDRGQPIRSTDVGFTPPSSPPTRPRNDRNVFSRLTSNQSQGSALDKSDDSDSSLSEVLRGIISPVGGAK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KIF21B (XP_371332, 1183 a.a. ~ 1282 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23046
Clone Number 4C12
Iso type IgG2a Kappa

Enviar un mensaje


KIF21B monoclonal antibody (M03), clone 4C12

KIF21B monoclonal antibody (M03), clone 4C12