PDZRN3 purified MaxPab mouse polyclonal antibody (B01P)
  • PDZRN3 purified MaxPab mouse polyclonal antibody (B01P)

PDZRN3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023024-B01P
PDZRN3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PDZRN3 protein.
Información adicional
Size 50 ug
Gene Name PDZRN3
Gene Alias LNX3|SEMACAP3
Gene Description PDZ domain containing ring finger 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGFELDRFDGDVDPDLKCALCHKVLEDPLTTPCGHVFCAGCVLPWVVQEGSCPARCRGRLSAKELNHVLPLKRLILKLDIKCAYATRGCGRVVKLQQLPEHLERCDFAPARCRHAGCGQVLLRRDVEAHMRDACDARPVGRCQEGCGLPLTHGEQRAGGHCCARALRAHNGALQARLGALHKALKKEALRAGKREKSLVAQLAAAQLELQMTALRYQKKFTEYSARLDSLSRCVAAPPGGKGEETKSLTLVLHRD
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PDZRN3 (NP_055824.1, 1 a.a. ~ 1066 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23024

Enviar un mensaje


PDZRN3 purified MaxPab mouse polyclonal antibody (B01P)

PDZRN3 purified MaxPab mouse polyclonal antibody (B01P)