KIAA0992 polyclonal antibody (A01)
  • KIAA0992 polyclonal antibody (A01)

KIAA0992 polyclonal antibody (A01)

Ref: AB-H00023022-A01
KIAA0992 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant KIAA0992.
Información adicional
Size 50 uL
Gene Name PALLD
Gene Alias CGI-151|FLJ22190|FLJ38193|FLJ39139|KIAA0992|PNCA1|SIH002
Gene Description palladin, cytoskeletal associated protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAPFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KIAA0992 (NP_057165, 775 a.a. ~ 839 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23022

Enviar un mensaje


KIAA0992 polyclonal antibody (A01)

KIAA0992 polyclonal antibody (A01)