CNOT1 polyclonal antibody (A01)
  • CNOT1 polyclonal antibody (A01)

CNOT1 polyclonal antibody (A01)

Ref: AB-H00023019-A01
CNOT1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant CNOT1.
Información adicional
Size 50 uL
Gene Name CNOT1
Gene Alias AD-005|CDC39|DKFZp686E0722|DKFZp686O168|FLJ36492|FLJ90644|KIAA1007|NOT1|NOT1H
Gene Description CCR4-NOT transcription complex, subunit 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq NSHTHYFSCTMLYLFAEANTEAIQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNHEFVHCAPEIEKLFQSVAQCCMGQKQAQQVMEGTGA
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen CNOT1 (NP_057368, 2278 a.a. ~ 2375 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 23019

Enviar un mensaje


CNOT1 polyclonal antibody (A01)

CNOT1 polyclonal antibody (A01)