MAPKBP1 purified MaxPab mouse polyclonal antibody (B01P)
  • MAPKBP1 purified MaxPab mouse polyclonal antibody (B01P)

MAPKBP1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00023005-B01P
MAPKBP1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MAPKBP1 protein.
Información adicional
Size 50 ug
Gene Name MAPKBP1
Gene Alias MGC138851|MGC138852
Gene Description mitogen-activated protein kinase binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGTLRVHELQSLSEMLKVEAHDSEILCLEYSKPDTGLKLLASASRDRLIHVLDAGREYSLQQTLDEHSSSITAVKFAASDGQVRMISCGADKSIYFRTAQKSGDGVQFTRTHHVVRKTTLYDMDVEPSWKYTAIGCQDRNIRIFNISSGKQKKLFKGSQGEDGTLIKVQTDPSGIYIATSCSDKNLSIFDFSSGECVATMFGHSEIVTGMKFSNDCKHLISVSGDSCIFVWRLSSEMTISMRQRLAELRQRQRGG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MAPKBP1 (AAH36660.1, 1 a.a. ~ 1015 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23005

Enviar un mensaje


MAPKBP1 purified MaxPab mouse polyclonal antibody (B01P)

MAPKBP1 purified MaxPab mouse polyclonal antibody (B01P)