DAAM1 monoclonal antibody (M03), clone 4H3
  • DAAM1 monoclonal antibody (M03), clone 4H3

DAAM1 monoclonal antibody (M03), clone 4H3

Ref: AB-H00023002-M03
DAAM1 monoclonal antibody (M03), clone 4H3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DAAM1.
Información adicional
Size 100 ug
Gene Name DAAM1
Gene Alias FLJ41657|KIAA0666
Gene Description dishevelled associated activator of morphogenesis 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,S-ELISA,ELISA,PLA-Ce
Immunogen Prot. Seq MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKHREAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DAAM1 (NP_055807, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 23002
Clone Number 4H3
Iso type IgG2a Kappa

Enviar un mensaje


DAAM1 monoclonal antibody (M03), clone 4H3

DAAM1 monoclonal antibody (M03), clone 4H3