DIP2C purified MaxPab mouse polyclonal antibody (B01P)
  • DIP2C purified MaxPab mouse polyclonal antibody (B01P)

DIP2C purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00022982-B01P
DIP2C purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human DIP2C protein.
Información adicional
Size 50 ug
Gene Name DIP2C
Gene Alias FLJ34444|FLJ44075|KIAA0934
Gene Description DIP2 disco-interacting protein 2 homolog C (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MADRSLEGMALPLEVRARLAELELELSEGDITQKGYEKKRSKLIGAYLPQPPRVDQALPQERRAPVTPSSASRYHRRRSSGSRDERYRSDVHTEAVQAALAKHKERKMAVPMPSKRRSLVVQTSMDAYTPPDTSSGSEDEGSVQGDSQGTPTSSQGSINMEHWISQAIHGSTTSTTSSSSTQSGGSGAAHRLADVMAQTHIENHSAPPDVTTYTSEHSIQVERPQGSTGSRTAPKYGNAELMETGDGVPVSSRVS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen DIP2C (NP_055789.1, 1 a.a. ~ 1556 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22982

Enviar un mensaje


DIP2C purified MaxPab mouse polyclonal antibody (B01P)

DIP2C purified MaxPab mouse polyclonal antibody (B01P)