SLC4A1AP monoclonal antibody (M01), clone 2G10
  • SLC4A1AP monoclonal antibody (M01), clone 2G10

SLC4A1AP monoclonal antibody (M01), clone 2G10

Ref: AB-H00022950-M01
SLC4A1AP monoclonal antibody (M01), clone 2G10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SLC4A1AP.
Información adicional
Size 100 ug
Gene Name SLC4A1AP
Gene Alias FLJ10624|FLJ41004|HLC3|MGC120646|MGC120648
Gene Description solute carrier family 4 (anion exchanger), member 1, adaptor protein
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq YQEPPWGGPATAPYSLETLKGGTILGTRSLKGTSYCLFGRLSGCDVCLEHPSVSRYHAVLQHRASGPDGECDSNGPGFYLYDLGSTHGTFLNKTRIPPRTY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SLC4A1AP (NP_060628, 154 a.a. ~ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22950
Clone Number 2G10
Iso type IgG2a Kappa

Enviar un mensaje


SLC4A1AP monoclonal antibody (M01), clone 2G10

SLC4A1AP monoclonal antibody (M01), clone 2G10