Ver mas grande
SLC4A1AP monoclonal antibody (M01), clone 2G10
AB-H00022950-M01
Producto nuevo
SLC4A1AP monoclonal antibody (M01), clone 2G10
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 ug |
| Gene Name | SLC4A1AP |
| Gene Alias | FLJ10624|FLJ41004|HLC3|MGC120646|MGC120648 |
| Gene Description | solute carrier family 4 (anion exchanger), member 1, adaptor protein |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,WB-Re,S-ELISA,ELISA |
| Immunogen Prot. Seq | YQEPPWGGPATAPYSLETLKGGTILGTRSLKGTSYCLFGRLSGCDVCLEHPSVSRYHAVLQHRASGPDGECDSNGPGFYLYDLGSTHGTFLNKTRIPPRTY |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | SLC4A1AP (NP_060628, 154 a.a. ~ 254 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 22950 |
| Clone Number | 2G10 |
| Iso type | IgG2a Kappa |
Más información
Mouse monoclonal antibody raised against a partial recombinant SLC4A1AP.