LTB4DH polyclonal antibody (A01)
  • LTB4DH polyclonal antibody (A01)

LTB4DH polyclonal antibody (A01)

Ref: AB-H00022949-A01
LTB4DH polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant LTB4DH.
Información adicional
Size 50 uL
Gene Name PTGR1
Gene Alias LTB4DH|MGC34943|ZADH3
Gene Description prostaglandin reductase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MKKFGRIAICGAISTYNRTGPLPPGPPPEIVIYQELRMEAFVVYRWQGDARQKALKDLLKWVLEGKIQYKEYIIEGFENMPAAFMGMLKGDNLGKTIVK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LTB4DH (NP_036344, 230 a.a. ~ 328 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 22949

Enviar un mensaje


LTB4DH polyclonal antibody (A01)

LTB4DH polyclonal antibody (A01)