DKK1 monoclonal antibody (M02), clone 1F5
  • DKK1 monoclonal antibody (M02), clone 1F5

DKK1 monoclonal antibody (M02), clone 1F5

Ref: AB-H00022943-M02
DKK1 monoclonal antibody (M02), clone 1F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant DKK1.
Información adicional
Size 100 ug
Gene Name DKK1
Gene Alias DKK-1|SK
Gene Description dickkopf homolog 1 (Xenopus laevis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QPYPCAEDEECGTDEYCASPTRGGDAGVQICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESFGNDHSTLDGYSRRTTLSSKMYH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DKK1 (NP_036374, 81 a.a. ~ 180 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22943
Clone Number 1F5
Iso type IgG2b Kappa

Enviar un mensaje


DKK1 monoclonal antibody (M02), clone 1F5

DKK1 monoclonal antibody (M02), clone 1F5