RPIA purified MaxPab rabbit polyclonal antibody (D01P)
  • RPIA purified MaxPab rabbit polyclonal antibody (D01P)

RPIA purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00022934-D01P
RPIA purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RPIA protein.
Información adicional
Size 100 ug
Gene Name RPIA
Gene Alias RPI
Gene Description ribose 5-phosphate isomerase A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MSKAEEAKKLAGRAAVENHVRNNQVLGIGSGSTIVHAVQRIAERVKQENLNLVCIPTSFQARQLILQYGLTLSDLDRHPEIDLAIDGADEVDADLNLIKGGGGCLTQEKIVAGYASRFIVIADFRKDSKNLGDQWHKGIPIEVIPMAYVPVSRAVSQKFGGVVELRMAVNKAGPVVTDNGNFILDWKFDRVHKWSEVNTAIKMIPGVVDTGLFINMAERVYFGMQDGSVNMREKPFC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RPIA (ENSP00000283646, 1 a.a. ~ 237 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22934

Enviar un mensaje


RPIA purified MaxPab rabbit polyclonal antibody (D01P)

RPIA purified MaxPab rabbit polyclonal antibody (D01P)