SIRT2 monoclonal antibody (M01), clone 4B11
  • SIRT2 monoclonal antibody (M01), clone 4B11

SIRT2 monoclonal antibody (M01), clone 4B11

Ref: AB-H00022933-M01
SIRT2 monoclonal antibody (M01), clone 4B11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SIRT2.
Información adicional
Size 100 ug
Gene Name SIRT2
Gene Alias SIR2|SIR2L|SIR2L2
Gene Description sirtuin (silent mating type information regulation 2 homolog) 2 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA,RNAi-Ab,IF
Immunogen Prot. Seq YTQNIDTLERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDIVFFGESLPARFFSCMQSDFLKVDLLLVMGTSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SIRT2 (AAH03012, 128 a.a. ~ 227 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22933
Clone Number 4B11
Iso type IgG1 Kappa

Enviar un mensaje


SIRT2 monoclonal antibody (M01), clone 4B11

SIRT2 monoclonal antibody (M01), clone 4B11