SEPHS2 monoclonal antibody (M02), clone 2G9
  • SEPHS2 monoclonal antibody (M02), clone 2G9

SEPHS2 monoclonal antibody (M02), clone 2G9

Ref: AB-H00022928-M02
SEPHS2 monoclonal antibody (M02), clone 2G9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SEPHS2.
Información adicional
Size 100 ug
Gene Name SEPHS2
Gene Alias SPS2
Gene Description selenophosphate synthetase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq GCKVPQEALLKLLAGLTRPDVRPPLGRGLVGGQEEASQEAGLPAGAGPSPTFPALGIGMDSCVIPLRHGGLSLVQTTDFFYPLVEDPYMM
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SEPHS2 (NP_036380.2, 61 a.a. ~ 150 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22928
Clone Number 2G9
Iso type IgG1 Kappa

Enviar un mensaje


SEPHS2 monoclonal antibody (M02), clone 2G9

SEPHS2 monoclonal antibody (M02), clone 2G9