Ver mas grande
ATF6 purified MaxPab mouse polyclonal antibody (B01P)
AB-H00022926-B01P
Producto nuevo
ATF6 purified MaxPab mouse polyclonal antibody (B01P)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 50 ug |
| Gene Name | ATF6 |
| Gene Alias | ATF6A |
| Gene Description | activating transcription factor 6 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Tr,IF |
| Immunogen Prot. Seq | MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLVPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTISSIPPQT |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | ATF6 (AAH14969.1, 1 a.a. ~ 202 a.a) full-length human protein. |
| Storage Buffer | In 1x PBS, pH 7.4 |
| Gene ID | 22926 |
Más información
Mouse polyclonal antibody raised against a full-length human ATF6 protein.