MSRB2 polyclonal antibody (A01)
  • MSRB2 polyclonal antibody (A01)

MSRB2 polyclonal antibody (A01)

Ref: AB-H00022921-A01
MSRB2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MSRB2.
Información adicional
Size 50 uL
Gene Name MSRB2
Gene Alias CBS-1|CBS1|CGI-131|MGC26104|MSRB|PILB
Gene Description methionine sulfoxide reductase B2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq KEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAHGTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAHLGHVFPDGPGPNGQRFCINSVALKFKPRKH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MSRB2 (NP_036360, 102 a.a. ~ 201 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 22921

Enviar un mensaje


MSRB2 polyclonal antibody (A01)

MSRB2 polyclonal antibody (A01)