MAPRE1 monoclonal antibody (M02), clone 4F3
  • MAPRE1 monoclonal antibody (M02), clone 4F3

MAPRE1 monoclonal antibody (M02), clone 4F3

Ref: AB-H00022919-M02
MAPRE1 monoclonal antibody (M02), clone 4F3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant MAPRE1.
Información adicional
Size 100 ug
Gene Name MAPRE1
Gene Alias EB1|MGC117374|MGC129946
Gene Description microtubule-associated protein, RP/EB family, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAPRE1 (NP_036457, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22919
Clone Number 4F3
Iso type IgG2a Kappa

Enviar un mensaje


MAPRE1 monoclonal antibody (M02), clone 4F3

MAPRE1 monoclonal antibody (M02), clone 4F3