MAPRE1 polyclonal antibody (A01)
  • MAPRE1 polyclonal antibody (A01)

MAPRE1 polyclonal antibody (A01)

Ref: AB-H00022919-A01
MAPRE1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant MAPRE1.
Información adicional
Size 50 uL
Gene Name MAPRE1
Gene Alias EB1|MGC117374|MGC129946
Gene Description microtubule-associated protein, RP/EB family, member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQW
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen MAPRE1 (NP_036457, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 22919

Enviar un mensaje


MAPRE1 polyclonal antibody (A01)

MAPRE1 polyclonal antibody (A01)