SACM1L purified MaxPab rabbit polyclonal antibody (D01P)
  • SACM1L purified MaxPab rabbit polyclonal antibody (D01P)

SACM1L purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00022908-D01P
SACM1L purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SACM1L protein.
Información adicional
Size 100 ug
Gene Name SACM1L
Gene Alias DKFZp686A0231|KIAA0851|SAC1
Gene Description SAC1 suppressor of actin mutations 1-like (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MATAAYEQLKLHITPEKFYVEACDDGADDVLTIDRVSTEVTLAVKKDVPPSAVTRPIFGILGTIHLVAGNYLIVITKKIKVGEFFSHVVWKATDFDVLSYKKTMLHLTDIQLQDNKTFLAMLNHVLNVDGFYFSTTYDLTHTLQRLSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQPEVHRFALPVLHGFITMHSCSINGKYFDWILISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYNGSKASFVQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SACM1L (AAH16559.1, 1 a.a. ~ 587 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22908

Enviar un mensaje


SACM1L purified MaxPab rabbit polyclonal antibody (D01P)

SACM1L purified MaxPab rabbit polyclonal antibody (D01P)