CARD8 purified MaxPab rabbit polyclonal antibody (D01P)
  • CARD8 purified MaxPab rabbit polyclonal antibody (D01P)

CARD8 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00022900-D01P
CARD8 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human CARD8 protein.
Información adicional
Size 100 ug
Gene Name CARD8
Gene Alias CARDINAL|DACAR|DKFZp779L0366|Dakar|FLJ18119|FLJ18121|KIAA0955|MGC57162|NDPP|NDPP1|TUCAN
Gene Description caspase recruitment domain family, member 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MEKKECPEKSSSSEEELPRRDSGSSRNIDASKLIRLQGSRKLLVDNSIRELQYTKTGIFFQAEACVTNDTVYRELPCVSETLCDISHFFQEDDETEAEPLLFRAVPECQLSGGDIPSVSEEQESSEGQDSGDICSEENQIVSSYASKVCFEIEEDYKNRQFLGPEGNVDVELIDKSTNRYSVWFPTAGWYLWSATGLGFLVRDEVTVTIAFGSWSQHLALDLQHHEQWLVGGPLFDVTAEPEEAVAEIHLPHSIS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CARD8 (AAH56891.1, 1 a.a. ~ 392 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22900

Enviar un mensaje


CARD8 purified MaxPab rabbit polyclonal antibody (D01P)

CARD8 purified MaxPab rabbit polyclonal antibody (D01P)