DIS3 polyclonal antibody (A01)
  • DIS3 polyclonal antibody (A01)

DIS3 polyclonal antibody (A01)

Ref: AB-H00022894-A01
DIS3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant DIS3.
Información adicional
Size 50 uL
Gene Name DIS3
Gene Alias DKFZp667L1817|EXOSC11|FLJ10484|KIAA1008|MGC33035|RP11-342J4.3|RRP44|bA555G22.1|dis3p
Gene Description DIS3 mitotic control homolog (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VVLIPKYGLEGTVFFEEKDKPNPQLIYDDEIPSLKIEDTVFHVFDKVKVKIMLDSSNLQHQKIRMSLVEPQIPGISIPTDTSNMDLNGPKKKKMKL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen DIS3 (NP_055768, 861 a.a. ~ 956 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 22894

Enviar un mensaje


DIS3 polyclonal antibody (A01)

DIS3 polyclonal antibody (A01)