ZHX2 purified MaxPab mouse polyclonal antibody (B01P)
  • ZHX2 purified MaxPab mouse polyclonal antibody (B01P)

ZHX2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00022882-B01P
ZHX2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human ZHX2 protein.
Información adicional
Size 50 ug
Gene Name ZHX2
Gene Alias AFR1|KIAA0854|RAF
Gene Description zinc fingers and homeoboxes 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MASKRKSTTPCMVRTSQVVEQDVPEEVDRAKEKGIGTPQPDVAKDSWAAELENSSKENEVIEVKSMGESQSKKLQGGYECKYCPYSTQNLNEFTEHVDMQHPNVILNPLYVCAECNFTTKKYDSLSDHNSKFHPGEANFKLKLIKRNNQTVLEQSIETTNHVVSITTSGPGTGDSDSGISVSKTPIMKPGKPKADAKKVPKKPEEITPENHVEGTARLVTDTAEILSRLGGVELLQDTLGHVMPSVQLPPNINLV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ZHX2 (NP_055758.1, 1 a.a. ~ 837 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22882

Enviar un mensaje


ZHX2 purified MaxPab mouse polyclonal antibody (B01P)

ZHX2 purified MaxPab mouse polyclonal antibody (B01P)