PLEKHA6 monoclonal antibody (M03), clone 1A4
  • PLEKHA6 monoclonal antibody (M03), clone 1A4

PLEKHA6 monoclonal antibody (M03), clone 1A4

Ref: AB-H00022874-M03
PLEKHA6 monoclonal antibody (M03), clone 1A4

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant PLEKHA6.
Información adicional
Size 100 ug
Gene Name PLEKHA6
Gene Alias KIAA0969|MGC176733|PEPP3
Gene Description pleckstrin homology domain containing, family A member 6
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq MHPRWAARLPLFISLLERADSVTAAYAKQH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLEKHA6 (AAH10522.1, 1 a.a. ~ 30 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22874
Clone Number 1A4
Iso type IgG1 Kappa

Enviar un mensaje


PLEKHA6 monoclonal antibody (M03), clone 1A4

PLEKHA6 monoclonal antibody (M03), clone 1A4