NLGN1 polyclonal antibody (A01)
  • NLGN1 polyclonal antibody (A01)

NLGN1 polyclonal antibody (A01)

Ref: AB-H00022871-A01
NLGN1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant NLGN1.
Información adicional
Size 50 uL
Gene Name NLGN1
Gene Alias KIAA1070|MGC45115
Gene Description neuroligin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq YSQKDQLYLHIGLKPRVKEHYRANKVNLWLELVPHLHNLNDISQYTSTTTKVPSTDITFRPTRKNSVPVTSAFPTAKQDDPKQQPSPFSVDQRDYSTELS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NLGN1 (NP_055747, 578 a.a. ~ 677 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 22871

Enviar un mensaje


NLGN1 polyclonal antibody (A01)

NLGN1 polyclonal antibody (A01)