LPHN1 purified MaxPab rabbit polyclonal antibody (D01P)
  • LPHN1 purified MaxPab rabbit polyclonal antibody (D01P)

LPHN1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00022859-D01P
LPHN1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LPHN1 protein.
Información adicional
Size 100 ug
Gene Name LPHN1
Gene Alias CIRL1|CL1|LEC2
Gene Description latrophilin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGLISHLERLMAEGKWGGTGVVEGMGMAEEGAGNGKAVWGMGRGKGERSPSLSSTFPQGRRSQVPGLGSGHPCSGRLDPKSQTPEAPGSGCVLSTCPGPLLSSLSGQPPQPPSLNSRGSIAPGHPSPAPALPFPQRWPLHLCSDLSPSLCPSFSHKCHEFSNIFGSQPAAAMNFVGLRGRGSRKELGGRGQVGGWRDPFCC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LPHN1 (AAH19928.1, 1 a.a. ~ 201 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22859

Enviar un mensaje


LPHN1 purified MaxPab rabbit polyclonal antibody (D01P)

LPHN1 purified MaxPab rabbit polyclonal antibody (D01P)