ICK purified MaxPab rabbit polyclonal antibody (D01P)
  • ICK purified MaxPab rabbit polyclonal antibody (D01P)

ICK purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00022858-D01P
ICK purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ICK protein.
Información adicional
Size 100 ug
Gene Name ICK
Gene Alias KIAA0936|LCK2|MGC46090|MRK
Gene Description intestinal cell (MAK-like) kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MNRYTTIRQLGDGTYGSVLLGRSIESGELIAIKKMKRKFYSWEECMNLREVKSLKKLNHANVVKLKEVIRENDHLYFIFEYMKENLYQLIKERNKLFPESAIRNIMYQILQGLAFIHKHGFFHRDLKPENLLCMGPELVKIADFGLAREIRSKPPYTDYVSTRWYRAPEVLLRSTNYSSPIDVWAVGCIMAEVYTLRPLFPGASEIDTIFKICQVLGTPKKTDWPEGYQLSSAMNFRWPQCVPNNLKTLIPNASS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ICK (NP_055735.1, 1 a.a. ~ 632 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22858

Enviar un mensaje


ICK purified MaxPab rabbit polyclonal antibody (D01P)

ICK purified MaxPab rabbit polyclonal antibody (D01P)