VASH1 polyclonal antibody (A01)
  • VASH1 polyclonal antibody (A01)

VASH1 polyclonal antibody (A01)

Ref: AB-H00022846-A01
VASH1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant VASH1.
Información adicional
Size 50 uL
Gene Name VASH1
Gene Alias KIAA1036
Gene Description vasohibin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq GGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen VASH1 (NP_055724, 3 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 22846

Enviar un mensaje


VASH1 polyclonal antibody (A01)

VASH1 polyclonal antibody (A01)