RHOBTB3 monoclonal antibody (M04), clone 3A10
  • RHOBTB3 monoclonal antibody (M04), clone 3A10

RHOBTB3 monoclonal antibody (M04), clone 3A10

Ref: AB-H00022836-M04
RHOBTB3 monoclonal antibody (M04), clone 3A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RHOBTB3.
Información adicional
Size 100 ug
Gene Name RHOBTB3
Gene Alias KIAA0878
Gene Description Rho-related BTB domain containing 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key S-ELISA,ELISA
Immunogen Prot. Seq MSIHIVALGNEGDTFHQDNRPSGLIRTYLGRSPLVSGDESSLLLNAASTVARPVFTEYQASAFGNVKLVVHDCPVWDIFDSDWYTSRNLIGGADIIVIK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RHOBTB3 (NP_055714.2, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22836
Clone Number 3A10
Iso type IgG1 Kappa

Enviar un mensaje


RHOBTB3 monoclonal antibody (M04), clone 3A10

RHOBTB3 monoclonal antibody (M04), clone 3A10