MTF2 purified MaxPab rabbit polyclonal antibody (D01P)
  • MTF2 purified MaxPab rabbit polyclonal antibody (D01P)

MTF2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00022823-D01P
MTF2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MTF2 protein.
Información adicional
Size 100 ug
Gene Name MTF2
Gene Alias M96|PCL2|RP5-976O13.1|dJ976O13.2
Gene Description metal response element binding transcription factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MTF2 (AAH10013.1, 1 a.a. ~ 536 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22823

Enviar un mensaje


MTF2 purified MaxPab rabbit polyclonal antibody (D01P)

MTF2 purified MaxPab rabbit polyclonal antibody (D01P)