ATF5 monoclonal antibody (M07), clone 4G5
  • ATF5 monoclonal antibody (M07), clone 4G5

ATF5 monoclonal antibody (M07), clone 4G5

Ref: AB-H00022809-M07
ATF5 monoclonal antibody (M07), clone 4G5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ATF5.
Información adicional
Size 100 ug
Gene Name ATF5
Gene Alias ATFX|FLJ34666|HMFN0395
Gene Description activating transcription factor 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq MASLLKKELEQMEDFFLDAPLLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPVLDTLDLLAIYCRNEAGQEEVGMPPLPPPQQPPPPSPPQPSRLAPY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ATF5 (AAH05174.1, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22809
Clone Number 4G5
Iso type IgG2a Kappa

Enviar un mensaje


ATF5 monoclonal antibody (M07), clone 4G5

ATF5 monoclonal antibody (M07), clone 4G5