RRAS2 monoclonal antibody (M01A), clone 2D3-4B8
  • RRAS2 monoclonal antibody (M01A), clone 2D3-4B8

RRAS2 monoclonal antibody (M01A), clone 2D3-4B8

Ref: AB-H00022800-M01A
RRAS2 monoclonal antibody (M01A), clone 2D3-4B8

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant RRAS2.
Información adicional
Size 200 uL
Gene Name RRAS2
Gene Alias TC21
Gene Description related RAS viral (r-ras) oncogene homolog 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MAAAGWRDGSGQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAARLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPMILIGNKADLDHQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQECPPSPEPTRKEKDKKGCHCVIF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RRAS2 (AAH13106, 1 a.a. ~ 204 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 22800
Clone Number 2D3-4B8
Iso type IgG2a Kappa

Enviar un mensaje


RRAS2 monoclonal antibody (M01A), clone 2D3-4B8

RRAS2 monoclonal antibody (M01A), clone 2D3-4B8