COG2 monoclonal antibody (M01), clone 3H8
  • COG2 monoclonal antibody (M01), clone 3H8

COG2 monoclonal antibody (M01), clone 3H8

Ref: AB-H00022796-M01
COG2 monoclonal antibody (M01), clone 3H8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant COG2.
Información adicional
Size 100 ug
Gene Name COG2
Gene Alias LDLC
Gene Description component of oligomeric golgi complex 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKLGLQASDIKSFSALAELVAAAKDQATAEQP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COG2 (NP_031383, 639 a.a. ~ 738 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22796
Clone Number 3H8
Iso type IgG2b Kappa

Enviar un mensaje


COG2 monoclonal antibody (M01), clone 3H8

COG2 monoclonal antibody (M01), clone 3H8