COG2 polyclonal antibody (A01)
  • COG2 polyclonal antibody (A01)

COG2 polyclonal antibody (A01)

Ref: AB-H00022796-A01
COG2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant COG2.
Información adicional
Size 50 uL
Gene Name COG2
Gene Alias LDLC
Gene Description component of oligomeric golgi complex 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq LSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDDKIRLQLALDVEYLGEQIQKLGLQASDIKSFSALAELVAAAKDQATAEQP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COG2 (NP_031383, 639 a.a. ~ 738 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 22796

Enviar un mensaje


COG2 polyclonal antibody (A01)

COG2 polyclonal antibody (A01)