NID2 monoclonal antibody (M01), clone 4G8
  • NID2 monoclonal antibody (M01), clone 4G8

NID2 monoclonal antibody (M01), clone 4G8

Ref: AB-H00022795-M01
NID2 monoclonal antibody (M01), clone 4G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant NID2.
Información adicional
Size 100 ug
Gene Name NID2
Gene Alias -
Gene Description nidogen 2 (osteonidogen)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PNGLTFDPFSKLLCWADAGTKKLECTLPDGTGRRVIQNNLKYPFSIVSYADHFYHTDWRRDGVVSVNKHSGQFTDEYLPEQRSHLYGITAVYPYCPTGRK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen NID2 (NP_031387.2, 1276 a.a. ~ 1375 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 22795
Clone Number 4G8
Iso type IgG2b Kappa

Enviar un mensaje


NID2 monoclonal antibody (M01), clone 4G8

NID2 monoclonal antibody (M01), clone 4G8