PTK9L monoclonal antibody (M01), clone 2B5
  • PTK9L monoclonal antibody (M01), clone 2B5

PTK9L monoclonal antibody (M01), clone 2B5

Ref: AB-H00011344-M01
PTK9L monoclonal antibody (M01), clone 2B5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PTK9L.
Información adicional
Size 100 ug
Gene Name TWF2
Gene Alias A6RP|A6r|MSTP011|PTK9L
Gene Description twinfilin, actin-binding protein, homolog 2 (Drosophila)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,ELISA
Immunogen Prot. Seq FAGYQKHLSSCAAPAPLTSAERELQQIRINEVKTEISVESKHQTLQGLAFPLQPEAQRALQQLKQKMVNYIQMKLDLERETIELVHTEPTDVAQLPSRVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PTK9L (AAH00327, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11344
Clone Number 2B5
Iso type IgG1 Kappa

Enviar un mensaje


PTK9L monoclonal antibody (M01), clone 2B5

PTK9L monoclonal antibody (M01), clone 2B5