MGLL purified MaxPab rabbit polyclonal antibody (D01P)
  • MGLL purified MaxPab rabbit polyclonal antibody (D01P)

MGLL purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011343-D01P
MGLL purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MGLL protein.
Información adicional
Size 100 ug
Gene Name MGLL
Gene Alias HU-K5|HUK5|MGL
Gene Description monoglyceride lipase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq METGPEDPSSMPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MGLL (NP_009214.1, 1 a.a. ~ 313 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11343

Enviar un mensaje


MGLL purified MaxPab rabbit polyclonal antibody (D01P)

MGLL purified MaxPab rabbit polyclonal antibody (D01P)