Ver mas grande
RNF13 polyclonal antibody (A01)
AB-H00011342-A01
Producto nuevo
RNF13 polyclonal antibody (A01)
Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.
Hoja técnica
| Size | 50 uL |
| Gene Name | RNF13 |
| Gene Alias | FLJ93817|MGC13689|RZF |
| Gene Description | ring finger protein 13 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | WB-Re,ELISA |
| Immunogen Prot. Seq | LPARFGYRLPAEGLKGFLINSKPENACEPIVPPPVKDNSSGTFIVLIRRLDCNFDIKVLNAQRAGYKAAIVHNVDSDDLISMGSNDIEVLKKIDIPSVFI |
| Antigen species Target species | Human |
| Quality control testing | Antibody Reactive Against Recombinant Protein. |
| Immunogen | RNF13 (NP_009213, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag. |
| Storage Buffer | 50 % glycerol |
| Gene ID | 11342 |
Más información
Mouse polyclonal antibody raised against a partial recombinant RNF13.