RNF13 polyclonal antibody (A01) Ver mas grande

RNF13 polyclonal antibody (A01)

AB-H00011342-A01

Producto nuevo

RNF13 polyclonal antibody (A01)

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 2 Biopuntos. Su cesta contiene un total 2 Biopuntos puede ser convertido en un Biobonos Descuento 8.00EUR.


Hoja técnica

Size 50 uL
Gene Name RNF13
Gene Alias FLJ93817|MGC13689|RZF
Gene Description ring finger protein 13
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LPARFGYRLPAEGLKGFLINSKPENACEPIVPPPVKDNSSGTFIVLIRRLDCNFDIKVLNAQRAGYKAAIVHNVDSDDLISMGSNDIEVLKKIDIPSVFI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RNF13 (NP_009213, 51 a.a. ~ 150 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11342

Más información

Mouse polyclonal antibody raised against a partial recombinant RNF13.

Consulta sobre un producto

RNF13 polyclonal antibody (A01)

RNF13 polyclonal antibody (A01)