OIP5 purified MaxPab mouse polyclonal antibody (B01P)
  • OIP5 purified MaxPab mouse polyclonal antibody (B01P)

OIP5 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011339-B01P
OIP5 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human OIP5 protein.
Información adicional
Size 50 ug
Gene Name OIP5
Gene Alias 5730547N13Rik|LINT-25|MIS18beta
Gene Description Opa interacting protein 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPLGPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRSLGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVTPDQSKPEN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen OIP5 (NP_009211.1, 1 a.a. ~ 229 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11339

Enviar un mensaje


OIP5 purified MaxPab mouse polyclonal antibody (B01P)

OIP5 purified MaxPab mouse polyclonal antibody (B01P)