U2AF2 monoclonal antibody (M03), clone 5G8
  • U2AF2 monoclonal antibody (M03), clone 5G8

U2AF2 monoclonal antibody (M03), clone 5G8

Ref: AB-H00011338-M03
U2AF2 monoclonal antibody (M03), clone 5G8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant U2AF2.
Información adicional
Size 100 ug
Gene Name U2AF2
Gene Alias U2AF65
Gene Description U2 small nuclear RNA auxiliary factor 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA,IF
Immunogen Prot. Seq GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen U2AF2 (NP_001012496.1, 141 a.a. ~ 240 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11338
Clone Number 5G8
Iso type IgG1 Kappa

Enviar un mensaje


U2AF2 monoclonal antibody (M03), clone 5G8

U2AF2 monoclonal antibody (M03), clone 5G8