STK38 purified MaxPab rabbit polyclonal antibody (D01P)
  • STK38 purified MaxPab rabbit polyclonal antibody (D01P)

STK38 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011329-D01P
STK38 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human STK38 protein.
Información adicional
Size 100 ug
Gene Name STK38
Gene Alias NDR|NDR1
Gene Description serine/threonine kinase 38
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHARKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDILVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIHRDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen STK38 (NP_009202.1, 1 a.a. ~ 465 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11329

Enviar un mensaje


STK38 purified MaxPab rabbit polyclonal antibody (D01P)

STK38 purified MaxPab rabbit polyclonal antibody (D01P)