XAB1 monoclonal antibody (M01), clone 3E1 Ver mas grande

XAB1 monoclonal antibody (M01), clone 3E1

AB-H00011321-M01

Producto nuevo

XAB1 monoclonal antibody (M01), clone 3E1

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name GPN1
Gene Alias ATPBD1A|MBDIN|NTPBP|XAB1
Gene Description GPN-loop GTPase 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq ELQASGGPRHPVCLLVLGMAGSGKTTFVQRLTGHLHAQGTPPYVINLDPAVHEVPFPANIDIRDTVKYKEVMKQYGLGPNGGIVTSLNLFATRFDQVMKFIEKAQNMSKY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen XAB1 (AAH07451, 9 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11321
Clone Number 3E1
Iso type IgG1 Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant XAB1.

Consulta sobre un producto

XAB1 monoclonal antibody (M01), clone 3E1

XAB1 monoclonal antibody (M01), clone 3E1