PARK7 polyclonal antibody (A01)
  • PARK7 polyclonal antibody (A01)

PARK7 polyclonal antibody (A01)

Ref: AB-H00011315-A01
PARK7 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PARK7.
Información adicional
Size 50 uL
Gene Name PARK7
Gene Alias DJ-1|DJ1|FLJ27376|FLJ34360|FLJ92274
Gene Description Parkinson disease (autosomal recessive, early onset) 7
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MASKRALVILAKGAEEMETVIPVDVMRRAGIKVTVAGLAGKDPVQCSRDVVICPDASLEDAKKEGPYDVVVLPGGNLGAQNLSESAAVKEILKEQENRKG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PARK7 (AAH08188, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11315

Enviar un mensaje


PARK7 polyclonal antibody (A01)

PARK7 polyclonal antibody (A01)