LYPLA2 purified MaxPab mouse polyclonal antibody (B01P)
  • LYPLA2 purified MaxPab mouse polyclonal antibody (B01P)

LYPLA2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011313-B01P
LYPLA2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LYPLA2 protein.
Información adicional
Size 50 ug
Gene Name LYPLA2
Gene Alias APT-2|DJ886K2.4
Gene Description lysophospholipase II
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MCGNTMSVPLLTDAATVSGAERETAAVIFLHGLGDTGHSWADALSTIRLPHVKYICPHAPRIPVTLNMKMVMPSWFDLMGLSPDAPEDEAGIKKAAENIKALIEHEMKNGIPANRIVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGSAKDLAILQCHGELDPMVPVRFGALTAEKLRSVVTPARVQFKTYPGVMHSSCPQEMAAVKEFLEKLLPPV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LYPLA2 (NP_009191.1, 1 a.a. ~ 231 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11313

Enviar un mensaje


LYPLA2 purified MaxPab mouse polyclonal antibody (B01P)

LYPLA2 purified MaxPab mouse polyclonal antibody (B01P)