PNKP polyclonal antibody (A01)
  • PNKP polyclonal antibody (A01)

PNKP polyclonal antibody (A01)

Ref: AB-H00011284-A01
PNKP polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PNKP.
Información adicional
Size 50 uL
Gene Name PNKP
Gene Alias PNK
Gene Description polynucleotide kinase 3'-phosphatase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq DNTNPDAASRARYVQCARAAGVPCRCFLFTATLEQARHNNRFREMTDSSHIPVSDMVMYGYRKQFEAPTLAEGFSAILEIPFRLWVEPRLGRLYCQFSEG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PNKP (NP_009185, 422 a.a. ~ 521 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11284

Enviar un mensaje


PNKP polyclonal antibody (A01)

PNKP polyclonal antibody (A01)