CYP4F8 purified MaxPab mouse polyclonal antibody (B01P)
  • CYP4F8 purified MaxPab mouse polyclonal antibody (B01P)

CYP4F8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011283-B01P
CYP4F8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CYP4F8 protein.
Información adicional
Size 50 ug
Gene Name CYP4F8
Gene Alias CPF8|CYPIVF8
Gene Description cytochrome P450, family 4, subfamily F, polypeptide 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSLLSLSWLGLRPVAASPWLLLLVVGASWLLARILAWTYAFYHNGRRLRCFPQPRKQNWFLGHLGLVTPTEEGLRVLTQLVATYPQGFVRWLGPITPIINLCHPDIVRSVINTSDAITDKDIVFYKTLKPWLGDGLLLSVGDKWRHHRRLLTPAFHFNILKPYIKIFSKSANIMHAKWQRLAMEGSTCLDVFEHISLMTLDSLQKCIFSFDSNCQEKPSEYITAIMELSALVVKRNNQFFRYKDFLYFLTPCGRR
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CYP4F8 (AAI56577.1, 1 a.a. ~ 520 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11283

Enviar un mensaje


CYP4F8 purified MaxPab mouse polyclonal antibody (B01P)

CYP4F8 purified MaxPab mouse polyclonal antibody (B01P)