KLF8 MaxPab rabbit polyclonal antibody (D01)
  • KLF8 MaxPab rabbit polyclonal antibody (D01)

KLF8 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00011279-D01
KLF8 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human KLF8 protein.
Información adicional
Size 100 uL
Gene Name KLF8
Gene Alias BKLF3|DKFZp686O08126|DXS741|MGC138314|ZNF741
Gene Description Kruppel-like factor 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTVLTPGSVLTSSQSTGSQQILHVIHTIPSVSLPNKMGGLKTIPVVVQSLPMVYTTLPADGGPAAITVPLIGGDGKNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen KLF8 (NP_009181.2, 1 a.a. ~ 359 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 11279

Enviar un mensaje


KLF8 MaxPab rabbit polyclonal antibody (D01)

KLF8 MaxPab rabbit polyclonal antibody (D01)