KLF12 monoclonal antibody (M04), clone 3D2
  • KLF12 monoclonal antibody (M04), clone 3D2

KLF12 monoclonal antibody (M04), clone 3D2

Ref: AB-H00011278-M04
KLF12 monoclonal antibody (M04), clone 3D2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant KLF12.
Información adicional
Size 100 ug
Gene Name KLF12
Gene Alias AP-2rep|AP2REP|HSPC122
Gene Description Kruppel-like factor 12
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MNIHMKRKTIKNINTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNNVKGEPPEDSLSVDHFQTQTEPVDLSINKAR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen KLF12 (NP_009180, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11278
Clone Number 3D2
Iso type IgG2a Kappa

Enviar un mensaje


KLF12 monoclonal antibody (M04), clone 3D2

KLF12 monoclonal antibody (M04), clone 3D2